PDB entry 1jrp

View 1jrp on RCSB PDB site
Description: Crystal Structure of Xanthine Dehydrogenase inhibited by alloxanthine from Rhodobacter capsulatus
Class: oxidoreductase
Keywords: Partial Beta-Barrel; xdh; xo, OXIDOREDUCTASE
Deposited on 2001-08-14, released 2002-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xanthine dehydrogenase, chain A
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA04469 (0-461)
    Domains in SCOPe 2.07: d1jrpa1, d1jrpa2, d1jrpa3, d1jrpa4
  • Chain 'B':
    Compound: xanthine dehydrogenase, chain B
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA04470 (Start-776)
      • conflict (771)
    Domains in SCOPe 2.07: d1jrpb1, d1jrpb2
  • Chain 'C':
    Compound: xanthine dehydrogenase, chain A
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA04469 (0-461)
    Domains in SCOPe 2.07: d1jrpc1, d1jrpc2, d1jrpc3, d1jrpc4
  • Chain 'D':
    Compound: xanthine dehydrogenase, chain B
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA04470 (Start-776)
      • conflict (771)
    Domains in SCOPe 2.07: d1jrpd1, d1jrpd2
  • Chain 'E':
    Compound: xanthine dehydrogenase, chain A
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA04469 (0-461)
    Domains in SCOPe 2.07: d1jrpe1, d1jrpe2, d1jrpe3, d1jrpe4
  • Chain 'F':
    Compound: xanthine dehydrogenase, chain B
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA04470 (Start-776)
      • conflict (771)
    Domains in SCOPe 2.07: d1jrpf1, d1jrpf2
  • Chain 'G':
    Compound: xanthine dehydrogenase, chain A
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA04469 (0-461)
    Domains in SCOPe 2.07: d1jrpg1, d1jrpg2, d1jrpg3, d1jrpg4
  • Chain 'H':
    Compound: xanthine dehydrogenase, chain B
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA04470 (Start-776)
      • conflict (771)
    Domains in SCOPe 2.07: d1jrph1, d1jrph2
  • Heterogens: CA, FES, MTE, MOS, FAD, 141

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jrpA (A:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlaqlssgvrgqtapa
    flpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdg
    ygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppalia
    mgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqd
    isavcgclnltlkgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaq
    dftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpA (A:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlpaflpetsdaladw
    ylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdgygigagvtiaal
    rafaegphpalagllrrfaseqvrqvatiggniangspigdgppaliamgasltlrrgqe
    rrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqdisavcgclnltl
    kgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaqdftplsdmrasa
    ayrmnaaqamalryvrelsgeavavlevmp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jrpB (B:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpB (B:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jrpC (C:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlaqlssgvrgqtapa
    flpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdg
    ygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppalia
    mgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqd
    isavcgclnltlkgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaq
    dftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpC (C:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlpaflpetsdaladw
    ylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdgygigagvtiaal
    rafaegphpalagllrrfaseqvrqvatiggniangspigdgppaliamgasltlrrgqe
    rrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqdisavcgclnltl
    kgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaqdftplsdmrasa
    ayrmnaaqamalryvrelsgeavavlevmp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jrpD (D:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpD (D:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1jrpE (E:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlaqlssgvrgqtapa
    flpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdg
    ygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppalia
    mgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqd
    isavcgclnltlkgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaq
    dftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpE (E:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlpaflpetsdaladw
    ylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdgygigagvtiaal
    rafaegphpalagllrrfaseqvrqvatiggniangspigdgppaliamgasltlrrgqe
    rrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqdisavcgclnltl
    kgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaqdftplsdmrasa
    ayrmnaaqamalryvrelsgeavavlevmp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1jrpF (F:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpF (F:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1jrpG (G:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlaqlssgvrgqtapa
    flpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdg
    ygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppalia
    mgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqd
    isavcgclnltlkgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaq
    dftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpG (G:)
    meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
    naclmmlpqiagkalrtiegiaapdgrlhpvqqamidhhgsqcgfctpgfivsmaaahdr
    drkdyddllagnlcrctgyapilraaeaaageppadwlqadaaftlpaflpetsdaladw
    ylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretpdgygigagvtiaal
    rafaegphpalagllrrfaseqvrqvatiggniangspigdgppaliamgasltlrrgqe
    rrrmpledffleyrkqdrrpgefvesvtlpksapglrcyklskrfdqdisavcgclnltl
    kgskietariafggmagvpkraaafeaaligqdfredtiaaalpllaqdftplsdmrasa
    ayrmnaaqamalryvrelsgeavavlevmp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jrpH (H:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jrpH (H:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra