Lineage for d1jrpf2 (1jrp F:124-777)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 2540554Protein Xanthine dehydrogenase chain B, C-terminal domain [69813] (1 species)
  7. 2540555Species Rhodobacter capsulatus [TaxId:1061] [69814] (4 PDB entries)
  8. 2540570Domain d1jrpf2: 1jrp F:124-777 [67178]
    Other proteins in same PDB: d1jrpa1, d1jrpa2, d1jrpa3, d1jrpa4, d1jrpb1, d1jrpc1, d1jrpc2, d1jrpc3, d1jrpc4, d1jrpd1, d1jrpe1, d1jrpe2, d1jrpe3, d1jrpe4, d1jrpf1, d1jrpg1, d1jrpg2, d1jrpg3, d1jrpg4, d1jrph1
    complexed with 141, ca, fad, fes, mos, mte

Details for d1jrpf2

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
PDB Compounds: (F:) xanthine dehydrogenase, chain B

SCOPe Domain Sequences for d1jrpf2:

Sequence, based on SEQRES records: (download)

>d1jrpf2 d.133.1.1 (F:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
pailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaala
lpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaiaca
vaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsadl
slpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehlarg
mgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtrlqk
sanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnh
ggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmavkda
cetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatgfya
tpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigq
iegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetif
rskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra

Sequence, based on observed residues (ATOM records): (download)

>d1jrpf2 d.133.1.1 (F:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
pailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaala
lpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaiaca
vaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsadl
slpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehlarg
mgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaawns
tnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmvqv
aaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaare
gcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgrpf
lyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwlttee
lvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgisa
flalhdacaacgphwpdlqapatpeavlaavrraegra

SCOPe Domain Coordinates for d1jrpf2:

Click to download the PDB-style file with coordinates for d1jrpf2.
(The format of our PDB-style files is described here.)

Timeline for d1jrpf2: