Lineage for d1jrpg2 (1jrp G:1-84)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934124Protein Xanthine dehydrogenase chain A, N-terminal domain [69666] (1 species)
  7. 2934125Species Rhodobacter capsulatus [TaxId:1061] [69667] (2 PDB entries)
  8. 2934133Domain d1jrpg2: 1jrp G:1-84 [67180]
    Other proteins in same PDB: d1jrpa1, d1jrpa3, d1jrpa4, d1jrpb1, d1jrpb2, d1jrpc1, d1jrpc3, d1jrpc4, d1jrpd1, d1jrpd2, d1jrpe1, d1jrpe3, d1jrpe4, d1jrpf1, d1jrpf2, d1jrpg1, d1jrpg3, d1jrpg4, d1jrph1, d1jrph2
    complexed with 141, ca, fad, fes, mos, mte

Details for d1jrpg2

PDB Entry: 1jrp (more details), 3 Å

PDB Description: crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
PDB Compounds: (G:) xanthine dehydrogenase, chain A

SCOPe Domain Sequences for d1jrpg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrpg2 d.15.4.2 (G:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
meiafllngetrrvriedptqsllellraegltgtkegcnegdcgactvmirdaagsrav
naclmmlpqiagkalrtiegiaap

SCOPe Domain Coordinates for d1jrpg2:

Click to download the PDB-style file with coordinates for d1jrpg2.
(The format of our PDB-style files is described here.)

Timeline for d1jrpg2: