SCOP 1.59: Domain d1jn0o1: 1jn0 O:0-148,O:313-333

Lineage for d1jn0o1 (1jn0 O:0-148,O:313-333)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (12 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (1 PDB entry)

8. Domain d1jn0o1: 1jn0 O:0-148,O:313-333 [66919]
   Other proteins in same PDB: d1jn0a2, d1jn0b2, d1jn0o2

Details for d1jn0o1

PDB Entry: 1jn0, 3 Å

PDB Description: Crystal structure of the non-regulatory A4 isoform of spinach chloroplast glyceraldehyde-3-phosphate dehydrogenase complexed with NADP

SCOP Domain Sequences for d1jn0o1:

Sequence; same for both SEQRES and ATOM records:

>d1jn0o1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)}
klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
apgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq

Timeline for d1jn0o1:

• d1jn0o1 is new in SCOP 1.59
  
• d1jn0o1 appears in SCOP 1.61
  
• d1jn0o1 appears in the current release, SCOPe 2.08