Lineage for d1jn0b1 (1jn0 B:0-148,B:313-333)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118495Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (12 species)
  7. 118584Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (1 PDB entry)
  8. 118586Domain d1jn0b1: 1jn0 B:0-148,B:313-333 [66917]
    Other proteins in same PDB: d1jn0a2, d1jn0b2, d1jn0o2

Details for d1jn0b1

PDB Entry: 1jn0 (more details), 3 Å

PDB Description: Crystal structure of the non-regulatory A4 isoform of spinach chloroplast glyceraldehyde-3-phosphate dehydrogenase complexed with NADP

SCOP Domain Sequences for d1jn0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jn0b1 c.2.1.3 (B:0-148,B:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)}
klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
apgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq

SCOP Domain Coordinates for d1jn0b1:

Click to download the PDB-style file with coordinates for d1jn0b1.
(The format of our PDB-style files is described here.)

Timeline for d1jn0b1: