Lineage for d1jn0o1 (1jn0 O:0-148,O:313-333)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843784Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2843929Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)
    Uniprot P19866
  8. 2843957Domain d1jn0o1: 1jn0 O:0-148,O:313-333 [66919]
    Other proteins in same PDB: d1jn0a2, d1jn0b2, d1jn0o2
    complexed with ndp, so4

Details for d1jn0o1

PDB Entry: 1jn0 (more details), 3 Å

PDB Description: Crystal structure of the non-regulatory A4 isoform of spinach chloroplast glyceraldehyde-3-phosphate dehydrogenase complexed with NADP
PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase a

SCOPe Domain Sequences for d1jn0o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jn0o1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
apgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq

SCOPe Domain Coordinates for d1jn0o1:

Click to download the PDB-style file with coordinates for d1jn0o1.
(The format of our PDB-style files is described here.)

Timeline for d1jn0o1: