Lineage for d1jlld1 (1jll D:1-121)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845549Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 2845567Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species)
  7. 2845570Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)
  8. 2845582Domain d1jlld1: 1jll D:1-121 [66855]
    Other proteins in same PDB: d1jlla2, d1jllb1, d1jllb2, d1jlld2, d1jlle1, d1jlle2
    complexed with coa, po4, so4; mutant

Details for d1jlld1

PDB Entry: 1jll (more details), 2.69 Å

PDB Description: crystal structure analysis of the e197betaa mutant of e. coli scs
PDB Compounds: (D:) succinyl-CoA synthetase alpha subunit

SCOPe Domain Sequences for d1jlld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlld1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOPe Domain Coordinates for d1jlld1:

Click to download the PDB-style file with coordinates for d1jlld1.
(The format of our PDB-style files is described here.)

Timeline for d1jlld1: