SCOPe 2.08: Domain d1jlld1: 1jll D:1-121

Lineage for d1jlld1 (1jll D:1-121)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.8: CoA-binding domain [51900] (6 proteins)

6. Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species)

7. Species Escherichia coli [TaxId:562] [51902] (11 PDB entries)

8. Domain d1jlld1: 1jll D:1-121 [66855]
   Other proteins in same PDB: d1jlla2, d1jllb1, d1jllb2, d1jlld2, d1jlle1, d1jlle2
   complexed with coa, po4, so4; mutant

Details for d1jlld1

PDB Entry: 1jll, 2.69 Å

PDB Description: crystal structure analysis of the e197betaa mutant of e. coli scs

PDB Compounds: (D:) succinyl-CoA synthetase alpha subunit

SCOPe Domain Sequences for d1jlld1:

Sequence; same for both SEQRES and ATOM records:

>d1jlld1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

Timeline for d1jlld1:

• d1jlld1 first appeared in SCOP 1.59
  
• d1jlld1 appears in SCOPe 2.07