Lineage for d1jlld1 (1jll D:1-121)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) 
Family c.2.1.8: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51900] (1 protein) Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (2 species) 
Species Escherichia coli [TaxId:562] [51902] (6 PDB entries) 
Domain d1jlld1: 1jll D:1-121 [66855]
Other proteins in same PDB: d1jlla2, d1jllb1, d1jllb2, d1jlld2, d1jlle1, d1jlle2
Details for d1jlld1
PDB Entry: 1jll (more details), 2.69 Å
PDB Description: crystal structure analysis of the e197betaa mutant of e. coli scs
SCOP Domain Sequences for d1jlld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlld1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p
SCOP Domain Coordinates for d1jlld1:
Click to download the PDB-style file with coordinates for d1jlld1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jlld1:
- d1jlld1 is new in SCOP 1.59
- d1jlld1 appears in SCOP 1.61
- d1jlld1 appears in the current release, SCOPe 2.08
View in 3D
