SCOP 1.63: Domain d1hixa_: 1hix A:

Lineage for d1hixa_ (1hix A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (13 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Streptomyces sp. s38, xyl1 [TaxId:181109] [69240] (1 PDB entry)

8. Domain d1hixa_: 1hix A: [65839]

Details for d1hixa_

PDB Entry: 1hix, 2 Å

PDB Description: crystallographic analyses of family 11 endo-beta-1,4-xylanase xyl1 from streptomyces sp. s38

SCOP Domain Sequences for d1hixa_:

Sequence; same for both SEQRES and ATOM records:

>d1hixa_ b.29.1.11 (A:) Xylanase II {Streptomyces sp. s38, xyl1}
ittnqtgtnngyyysfwtdgggsvsmnlasggsygtswtncgnfvagkgwangarrtvny
sgsfnpsgnayltlygwtanplveyyivdnwgtyrptgtykgtvtsdggtydvyqttrvn
apsvegtktfnqywsvrqskrtggsitagnhfdawarygmplgsfnyymimategyqssg
sssis

Timeline for d1hixa_:

• d1hixa_ first appeared in SCOP 1.59
  
• d1hixa_ appears in SCOP 1.61
  
• d1hixa_ appears in SCOP 1.65
  
• d1hixa_ appears in the current release, SCOPe 2.08