Lineage for d1hixa_ (1hix A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374612Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 protein domains)
  6. 2374657Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2374746Species Streptomyces sp. s38, xyl1 [TaxId:181109] [69240] (1 PDB entry)
  8. 2374747Domain d1hixa_: 1hix A: [65839]

Details for d1hixa_

PDB Entry: 1hix (more details), 2 Å

PDB Description: crystallographic analyses of family 11 endo-beta-1,4-xylanase xyl1 from streptomyces sp. s38
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1hixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hixa_ b.29.1.11 (A:) Xylanase II {Streptomyces sp. s38, xyl1 [TaxId: 181109]}
ittnqtgtnngyyysfwtdgggsvsmnlasggsygtswtncgnfvagkgwangarrtvny
sgsfnpsgnayltlygwtanplveyyivdnwgtyrptgtykgtvtsdggtydvyqttrvn
apsvegtktfnqywsvrqskrtggsitagnhfdawarygmplgsfnyymimategyqssg
sssis

SCOPe Domain Coordinates for d1hixa_:

Click to download the PDB-style file with coordinates for d1hixa_.
(The format of our PDB-style files is described here.)

Timeline for d1hixa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hixb_