Lineage for d1hixa_ (1hix A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 165029Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 165041Protein Xylanase II [49979] (13 species)
  7. 165081Species Streptomyces sp. s38, xyl1 [TaxId:181109] [69240] (1 PDB entry)
  8. 165082Domain d1hixa_: 1hix A: [65839]

Details for d1hixa_

PDB Entry: 1hix (more details), 2 Å

PDB Description: crystallographic analyses of family 11 endo-beta-1,4-xylanase xyl1 from streptomyces sp. s38

SCOP Domain Sequences for d1hixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hixa_ b.29.1.11 (A:) Xylanase II {Streptomyces sp. s38, xyl1}
ittnqtgtnngyyysfwtdgggsvsmnlasggsygtswtncgnfvagkgwangarrtvny
sgsfnpsgnayltlygwtanplveyyivdnwgtyrptgtykgtvtsdggtydvyqttrvn
apsvegtktfnqywsvrqskrtggsitagnhfdawarygmplgsfnyymimategyqssg
sssis

SCOP Domain Coordinates for d1hixa_:

Click to download the PDB-style file with coordinates for d1hixa_.
(The format of our PDB-style files is described here.)

Timeline for d1hixa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hixb_