Lineage for d1hixb_ (1hix B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) 
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) Protein Xylanase II [49979] (13 species) 
Species Streptomyces sp. s38, xyl1 [TaxId:181109] [69240] (1 PDB entry) 
Domain d1hixb_: 1hix B: [65840]
Details for d1hixb_
PDB Entry: 1hix (more details), 2 Å
PDB Description: crystallographic analyses of family 11 endo-beta-1,4-xylanase xyl1 from streptomyces sp. s38
SCOP Domain Sequences for d1hixb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hixb_ b.29.1.11 (B:) Xylanase II {Streptomyces sp. s38, xyl1}
vittnqtgtnngyyysfwtdgggsvsmnlasggsygtswtncgnfvagkgwangarrtvn
ysgsfnpsgnayltlygwtanplveyyivdnwgtyrptgtykgtvtsdggtydvyqttrv
napsvegtktfnqywsvrqskrtggsitagnhfdawarygmplgsfnyymimategyqss
gsssisv
SCOP Domain Coordinates for d1hixb_:
Click to download the PDB-style file with coordinates for d1hixb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hixb_:
- d1hixb_ first appeared in SCOP 1.59
- d1hixb_ appears in SCOP 1.63
- d1hixb_ appears in the current release, SCOPe 2.08
View in 3D
