SCOPe 2.07: Domain d1hfua3: 1hfu A:304-503

Lineage for d1hfua3 (1hfu A:304-503)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Laccase [49557] (5 species)
   consists of three domains of this fold

7. Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries)

8. Domain d1hfua3: 1hfu A:304-503 [65829]
   Other proteins in same PDB: d1hfua4
   complexed with cu

Details for d1hfua3

PDB Entry: 1hfu, 1.68 Å

PDB Description: type-2 cu-depleted laccase from coprinus cinereus at 1.68 a resolution

PDB Compounds: (A:) laccase 1

SCOPe Domain Sequences for d1hfua3:

Sequence; same for both SEQRES and ATOM records:

>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]}
neadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqimsgaq
sandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvnpvk
rdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannppvew
aqlceiyddlppeatsiqtv

Timeline for d1hfua3:

• d1hfua3 first appeared in SCOP 1.59
  
• d1hfua3 appears in SCOPe 2.06
  
• d1hfua3 appears in the current release, SCOPe 2.08