Lineage for d1hfua3 (1hfu A:304-503)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins) 
Protein Laccase [49557] (1 species) Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries) 
Domain d1hfua3: 1hfu A:304-503 [65829]
Details for d1hfua3
PDB Entry: 1hfu (more details), 1.68 Å
PDB Description: type-2 cu-depleted laccase from coprinus cinereus at 1.68 a resolution
SCOP Domain Sequences for d1hfua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus)}
neadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqimsgaq
sandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvnpvk
rdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannppvew
aqlceiyddlppeatsiqtv
SCOP Domain Coordinates for d1hfua3:
Click to download the PDB-style file with coordinates for d1hfua3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hfua3:
- d1hfua3 is new in SCOP 1.59
- d1hfua3 appears in SCOP 1.61
- d1hfua3 appears in the current release, SCOPe 2.08
View in 3D
