Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Laccase, C-terminal domain [418907] (5 species) |
Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [419312] (2 PDB entries) |
Domain d1hfua3: 1hfu A:304-503 [65829] Other proteins in same PDB: d1hfua1, d1hfua2, d1hfua4 complexed with cu has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1hfu (more details), 1.68 Å
SCOPe Domain Sequences for d1hfua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfua3 b.6.1.3 (A:304-503) Laccase, C-terminal domain {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} neadlhalidpaapgiptpgaadvnlrfqlgfsggrftingtayespsvptllqimsgaq sandllpagsvyelprnqvvelvvpagvlggphpfhlhghafsvvrsagsstynfvnpvk rdvvslgvtgdevtirfvtdnpgpwffhchiefhlmnglaivfaedmantvdannppvew aqlceiyddlppeatsiqtv
Timeline for d1hfua3: