![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Laccase, N-terminal domain [418905] (5 species) |
![]() | Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [419310] (2 PDB entries) |
![]() | Domain d1hfua1: 1hfu A:2-131 [65827] Other proteins in same PDB: d1hfua2, d1hfua3, d1hfua4 complexed with cu |
PDB Entry: 1hfu (more details), 1.68 Å
SCOPe Domain Sequences for d1hfua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfua1 b.6.1.3 (A:2-131) Laccase, N-terminal domain {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} ivnsvdtmtltnanvspdgftragilvngvhgplirggkndnfelnvvndldnptmlrpt sihwhglfqrgtnwadgadgvnqcpispghaflykftpaghagtfwyhshfgtqycdglr gpmviyddnd
Timeline for d1hfua1: