Lineage for d1hfua1 (1hfu A:2-131)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381069Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 2381125Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries)
  8. 2381126Domain d1hfua1: 1hfu A:2-131 [65827]
    Other proteins in same PDB: d1hfua4
    complexed with cu

Details for d1hfua1

PDB Entry: 1hfu (more details), 1.68 Å

PDB Description: type-2 cu-depleted laccase from coprinus cinereus at 1.68 a resolution
PDB Compounds: (A:) laccase 1

SCOPe Domain Sequences for d1hfua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfua1 b.6.1.3 (A:2-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]}
ivnsvdtmtltnanvspdgftragilvngvhgplirggkndnfelnvvndldnptmlrpt
sihwhglfqrgtnwadgadgvnqcpispghaflykftpaghagtfwyhshfgtqycdglr
gpmviyddnd

SCOPe Domain Coordinates for d1hfua1:

Click to download the PDB-style file with coordinates for d1hfua1.
(The format of our PDB-style files is described here.)

Timeline for d1hfua1: