Lineage for d1hekb_ (1hek B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 917633Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 917634Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 917672Family a.61.1.5: EIAV matrix antigen [69051] (1 protein)
  6. 917673Protein EIAV matrix antigen [69052] (1 species)
  7. 917674Species Equine infectious anemia virus, EIAV [TaxId:11665] [69053] (1 PDB entry)
  8. 917676Domain d1hekb_: 1hek B: [65819]

Details for d1hekb_

PDB Entry: 1hek (more details), 2.8 Å

PDB Description: crystal structure of equine infectious anaemia virus matrix antigen (eiav ma)
PDB Compounds: (B:) gag polyprotein, core protein p15

SCOPe Domain Sequences for d1hekb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hekb_ a.61.1.5 (B:) EIAV matrix antigen {Equine infectious anemia virus, EIAV [TaxId: 11665]}
amadigsmgdpltwskalkklekvtvqgsqklttgncnwalslvdlfhdtnfvkekdwql
rdviplledvtqtlsgqereafertwwaisavkmglqinnvvdgkasfqllrakye

SCOPe Domain Coordinates for d1hekb_:

Click to download the PDB-style file with coordinates for d1hekb_.
(The format of our PDB-style files is described here.)

Timeline for d1hekb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1heka_