Lineage for d1hekb_ (1hek B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 98853Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
  4. 98854Superfamily a.61.1: Retroviral matrix proteins [47836] (5 families) (S)
  5. 98882Family a.61.1.5: EIAV matrix antigen [69051] (1 protein)
  6. 98883Protein EIAV matrix antigen [69052] (1 species)
  7. 98884Species Equine infectious anemia virus, EIAV [TaxId:11665] [69053] (1 PDB entry)
  8. 98886Domain d1hekb_: 1hek B: [65819]

Details for d1hekb_

PDB Entry: 1hek (more details), 2.8 Å

PDB Description: crystal structure of equine infectious anaemia virus matrix antigen (eiav ma)

SCOP Domain Sequences for d1hekb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hekb_ a.61.1.5 (B:) EIAV matrix antigen {Equine infectious anemia virus, EIAV}
amadigsmgdpltwskalkklekvtvqgsqklttgncnwalslvdlfhdtnfvkekdwql
rdviplledvtqtlsgqereafertwwaisavkmglqinnvvdgkasfqllrakye

SCOP Domain Coordinates for d1hekb_:

Click to download the PDB-style file with coordinates for d1hekb_.
(The format of our PDB-style files is described here.)

Timeline for d1hekb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1heka_