SCOPe 2.02: Domain d1hekb_: 1hek B:

Lineage for d1hekb_ (1hek B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.5: EIAV matrix antigen [69051] (1 protein)

6. Protein EIAV matrix antigen [69052] (1 species)

7. Species Equine infectious anemia virus, EIAV [TaxId:11665] [69053] (1 PDB entry)

8. Domain d1hekb_: 1hek B: [65819]

Details for d1hekb_

PDB Entry: 1hek, 2.8 Å

PDB Description: crystal structure of equine infectious anaemia virus matrix antigen (eiav ma)

PDB Compounds: (B:) gag polyprotein, core protein p15

SCOPe Domain Sequences for d1hekb_:

Sequence; same for both SEQRES and ATOM records:

>d1hekb_ a.61.1.5 (B:) EIAV matrix antigen {Equine infectious anemia virus, EIAV [TaxId: 11665]}
amadigsmgdpltwskalkklekvtvqgsqklttgncnwalslvdlfhdtnfvkekdwql
rdviplledvtqtlsgqereafertwwaisavkmglqinnvvdgkasfqllrakye

Timeline for d1hekb_:

• d1hekb_ first appeared in SCOP 1.59
  
• d1hekb_ appears in SCOPe 2.01
  
• d1hekb_ appears in SCOPe 2.03
  
• d1hekb_ appears in the current release, SCOPe 2.08, called d1hekb1