| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) ![]() the 5th, C-terminal helix is missing in some of the member structures |
| Family a.61.1.5: EIAV matrix antigen [69051] (1 protein) |
| Protein EIAV matrix antigen [69052] (1 species) |
| Species Equine infectious anemia virus, EIAV [TaxId:11665] [69053] (1 PDB entry) |
| Domain d1heka_: 1hek A: [65818] |
PDB Entry: 1hek (more details), 2.8 Å
SCOPe Domain Sequences for d1heka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1heka_ a.61.1.5 (A:) EIAV matrix antigen {Equine infectious anemia virus, EIAV [TaxId: 11665]}
amadigsmgdpltwskalkklekvtvqgsqklttgncnwalslvdlfhdtnfvkekdwql
rdviplledvtqtlsgqereafertwwaisavkmglqinnvvdgkasfqllrakye
Timeline for d1heka_: