Lineage for d1hcjb_ (1hcj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939786Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
    Uniprot P42212
  8. 2940050Domain d1hcjb_: 1hcj B: [65793]
    Photoproduct of the wild-type GFP

Details for d1hcjb_

PDB Entry: 1hcj (more details), 1.8 Å

PDB Description: photoproduct of the wild-type aequorea victoria green fluorescent protein
PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d1hcjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcjb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllafvtaagith

SCOPe Domain Coordinates for d1hcjb_:

Click to download the PDB-style file with coordinates for d1hcjb_.
(The format of our PDB-style files is described here.)

Timeline for d1hcjb_: