Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) |
Superfamily d.22.1: GFP-like [54511] (2 families) |
Family d.22.1.1: Fluorescent proteins [54512] (2 proteins) |
Protein Green fluorescent protein, GFP [54513] (1 species) |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (23 PDB entries) |
Domain d1hcjb_: 1hcj B: [65793] |
PDB Entry: 1hcj (more details), 1.8 Å
SCOP Domain Sequences for d1hcjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcjb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)} kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt tfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith
Timeline for d1hcjb_: