Lineage for d1hcjb_ (1hcj B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132152Fold d.22: GFP-like [54510] (1 superfamily)
  4. 132153Superfamily d.22.1: GFP-like [54511] (2 families) (S)
  5. 132154Family d.22.1.1: Fluorescent proteins [54512] (2 proteins)
  6. 132155Protein Green fluorescent protein, GFP [54513] (1 species)
  7. 132156Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (23 PDB entries)
  8. 132162Domain d1hcjb_: 1hcj B: [65793]

Details for d1hcjb_

PDB Entry: 1hcj (more details), 1.8 Å

PDB Description: photoproduct of the wild-type aequorea victoria green fluorescent protein

SCOP Domain Sequences for d1hcjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcjb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith

SCOP Domain Coordinates for d1hcjb_:

Click to download the PDB-style file with coordinates for d1hcjb_.
(The format of our PDB-style files is described here.)

Timeline for d1hcjb_: