SCOPe 2.08: Domain d1h89c2: 1h89 C:89-143

Lineage for d1h89c2 (1h89 C:89-143)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein c-Myb, DNA-binding domain [46740] (1 species)
   duplication

7. Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)

8. Domain d1h89c2: 1h89 C:89-143 [65727]
   Other proteins in same PDB: d1h89a_, d1h89b_
   repeat 1 is partly disordered
   protein/DNA complex; complexed with k

Details for d1h89c2

PDB Entry: 1h89, 2.45 Å

PDB Description: crystal structure of ternary protein-dna complex2

PDB Compounds: (C:) Myb proto-oncogene protein

SCOPe Domain Sequences for d1h89c2:

Sequence; same for both SEQRES and ATOM records:

>d1h89c2 a.4.1.3 (C:89-143) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
elikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevk

Timeline for d1h89c2:

• d1h89c2 first appeared in SCOP 1.59
  
• d1h89c2 appears in SCOPe 2.07