Lineage for d1h89c3 (1h89 C:144-191)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692037Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2692045Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 2692046Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 2692069Domain d1h89c3: 1h89 C:144-191 [65728]
    Other proteins in same PDB: d1h89a_, d1h89b_
    repeat 1 is partly disordered
    protein/DNA complex; complexed with k

Details for d1h89c3

PDB Entry: 1h89 (more details), 2.45 Å

PDB Description: crystal structure of ternary protein-dna complex2
PDB Compounds: (C:) Myb proto-oncogene protein

SCOPe Domain Sequences for d1h89c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h89c3 a.4.1.3 (C:144-191) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
ktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrr

SCOPe Domain Coordinates for d1h89c3:

Click to download the PDB-style file with coordinates for d1h89c3.
(The format of our PDB-style files is described here.)

Timeline for d1h89c3: