SCOPe 2.08: Domain d1gh6a1: 1gh6 A:7-117

Lineage for d1gh6a1 (1gh6 A:7-117)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
   Pfam PF00226

6. Protein Large T antigen, the N-terminal J domain [46573] (2 species)

7. Species Simian virus 40, Sv40 [TaxId:10633] [68943] (1 PDB entry)

8. Domain d1gh6a1: 1gh6 A:7-117 [65191]
   Other proteins in same PDB: d1gh6a2, d1gh6b1, d1gh6b2
   extended at the C-terminus
   has additional insertions and/or extensions that are not grouped together

Details for d1gh6a1

PDB Entry: 1gh6, 3.2 Å

PDB Description: retinoblastoma pocket complexed with sv40 large t antigen

PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d1gh6a1:

Sequence; same for both SEQRES and ATOM records:

>d1gh6a1 a.2.3.1 (A:7-117) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]}
reeslqlmdllglersawgniplmrkaylkkckefhpdkggdeekmkkmntlykkmedgv
kyahqpdfggfwdateiptygtdeweqwwnafneenlfcseempssddeat

Timeline for d1gh6a1:

• d1gh6a1 first appeared in SCOP 1.59, called d1gh6a_
  
• d1gh6a1 appears in SCOPe 2.07