![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.3: Chaperone J-domain [46565] (2 families) ![]() |
![]() | Family a.2.3.1: Chaperone J-domain [46566] (7 proteins) Pfam PF00226 |
![]() | Protein Large T antigen, the N-terminal J domain [46573] (2 species) |
![]() | Species Simian virus 40, Sv40 [TaxId:10633] [68943] (1 PDB entry) |
![]() | Domain d1gh6a1: 1gh6 A:7-117 [65191] Other proteins in same PDB: d1gh6a2, d1gh6b1, d1gh6b2 extended at the C-terminus has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1gh6 (more details), 3.2 Å
SCOPe Domain Sequences for d1gh6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gh6a1 a.2.3.1 (A:7-117) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} reeslqlmdllglersawgniplmrkaylkkckefhpdkggdeekmkkmntlykkmedgv kyahqpdfggfwdateiptygtdeweqwwnafneenlfcseempssddeat
Timeline for d1gh6a1: