![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein) |
![]() | Protein Retinoblastoma tumor suppressor domains [47970] (1 species) contains an additional C-terminal helix |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries) |
![]() | Domain d1gh6b2: 1gh6 B:645-772 [65193] Other proteins in same PDB: d1gh6a1, d1gh6a2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1gh6 (more details), 3.2 Å
SCOPe Domain Sequences for d1gh6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gh6b2 a.74.1.3 (B:645-772) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} tslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqim mcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqrl ktnilqya
Timeline for d1gh6b2: