Lineage for d1gh6b1 (1gh6 B:379-583)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718685Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 2718686Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 2718687Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)
  8. 2718711Domain d1gh6b1: 1gh6 B:379-583 [65192]
    Other proteins in same PDB: d1gh6a1, d1gh6a2
    has additional insertions and/or extensions that are not grouped together

Details for d1gh6b1

PDB Entry: 1gh6 (more details), 3.2 Å

PDB Description: retinoblastoma pocket complexed with sv40 large t antigen
PDB Compounds: (B:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d1gh6b1:

Sequence, based on SEQRES records: (download)

>d1gh6b1 a.74.1.3 (B:379-583) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagc
vaigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
srstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrim
eslawlsdsplfdlikqsklvprgs

Sequence, based on observed residues (ATOM records): (download)

>d1gh6b1 a.74.1.3 (B:379-583) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagc
vaigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
srsttdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawls
dsplfdlikqsklvprgs

SCOPe Domain Coordinates for d1gh6b1:

Click to download the PDB-style file with coordinates for d1gh6b1.
(The format of our PDB-style files is described here.)

Timeline for d1gh6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gh6b2