SCOPe 2.08: Domain d1g3tb1: 1g3t B:1003-1064

Lineage for d1g3tb1 (1g3t B:1003-1064)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
   Uniprot P33120

8. Domain d1g3tb1: 1g3t B:1003-1064 [65130]
   Other proteins in same PDB: d1g3ta2, d1g3ta3, d1g3tb2

Details for d1g3tb1

PDB Entry: 1g3t, 2.35 Å

PDB Description: cys102ser dtxr

PDB Compounds: (B:) diphtheria toxin repressor

SCOPe Domain Sequences for d1g3tb1:

Sequence; same for both SEQRES and ATOM records:

>d1g3tb1 a.4.5.24 (B:1003-1064) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
qm

Timeline for d1g3tb1:

• d1g3tb1 first appeared in SCOP 1.59
  
• d1g3tb1 appears in SCOPe 2.07