SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1g3ta2 (1g3t A:65-140)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001474Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2001475Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2001476Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 protein domains)
  6. 2001477Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 2001478Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
    Uniprot P33120
  8. 2001490Domain d1g3ta2: 1g3t A:65-140 [65128]
    Other proteins in same PDB: d1g3ta1, d1g3ta3, d1g3tb1

Details for d1g3ta2

PDB Entry: 1g3t (more details), 2.35 Å

PDB Description: cys102ser dtxr
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1g3ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ta2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeasrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOPe Domain Coordinates for d1g3ta2:

Click to download the PDB-style file with coordinates for d1g3ta2.
(The format of our PDB-style files is described here.)

Timeline for d1g3ta2: