SCOPe 2.08: Domain d1g1rb2: 1g1r B:119-158

Lineage for d1g1rb2 (1g1r B:119-158)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein E-selectin, EGF-domain [57203] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries)

8. Domain d1g1rb2: 1g1r B:119-158 [65095]
   Other proteins in same PDB: d1g1ra1, d1g1ra3, d1g1rb1, d1g1rb3, d1g1rc1, d1g1rc3, d1g1rd1, d1g1rd3
   complexed with ca, mrd

Details for d1g1rb2

PDB Entry: 1g1r, 3.4 Å

PDB Description: crystal structure of p-selectin lectin/egf domains complexed with slex

PDB Compounds: (B:) p-selectin

SCOPe Domain Sequences for d1g1rb2:

Sequence; same for both SEQRES and ATOM records:

>d1g1rb2 g.3.11.1 (B:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
tascqdmscskqgecletignytcscypgfygpeceyvrd

Timeline for d1g1rb2:

• d1g1rb2 first appeared in SCOP 1.59
  
• d1g1rb2 appears in SCOPe 2.07