Lineage for d1g1ra2 (1g1r A:119-158)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031291Protein E-selectin, EGF-domain [57203] (1 species)
  7. 3031292Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries)
  8. 3031301Domain d1g1ra2: 1g1r A:119-158 [65093]
    Other proteins in same PDB: d1g1ra1, d1g1ra3, d1g1rb1, d1g1rb3, d1g1rc1, d1g1rc3, d1g1rd1, d1g1rd3
    complexed with ca, mrd

Details for d1g1ra2

PDB Entry: 1g1r (more details), 3.4 Å

PDB Description: crystal structure of p-selectin lectin/egf domains complexed with slex
PDB Compounds: (A:) p-selectin

SCOPe Domain Sequences for d1g1ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1ra2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
tascqdmscskqgecletignytcscypgfygpeceyvrd

SCOPe Domain Coordinates for d1g1ra2:

Click to download the PDB-style file with coordinates for d1g1ra2.
(The format of our PDB-style files is described here.)

Timeline for d1g1ra2: