Lineage for d1jeqa1 (1jeq A:559-609)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734562Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2734582Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 2734583Family a.140.2.1: SAP domain [68907] (8 proteins)
    Pfam PF02037
  6. 2734584Protein DNA binding C-terminal domain of ku70 [68908] (1 species)
  7. 2734585Species Human (Homo sapiens) [TaxId:9606] [68909] (2 PDB entries)
  8. 2734586Domain d1jeqa1: 1jeq A:559-609 [64748]
    Other proteins in same PDB: d1jeqa3, d1jeqa4, d1jeqb1, d1jeqb2

Details for d1jeqa1

PDB Entry: 1jeq (more details), 2.7 Å

PDB Description: crystal structure of the ku heterodimer
PDB Compounds: (A:) Ku70

SCOPe Domain Sequences for d1jeqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens) [TaxId: 9606]}
yseeelkthiskgtlgkftvpmlkeacrayglksglkkqellealtkhfqd

SCOPe Domain Coordinates for d1jeqa1:

Click to download the PDB-style file with coordinates for d1jeqa1.
(The format of our PDB-style files is described here.)

Timeline for d1jeqa1: