Lineage for d1jeqb2 (1jeq B:6-241)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128912Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128913Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2129099Family c.62.1.4: Ku80 subunit N-terminal domain [100962] (1 protein)
    automatically mapped to Pfam PF03731
  6. 2129100Protein Ku80 subunit N-terminal domain [100963] (1 species)
  7. 2129101Species Human (Homo sapiens) [TaxId:9606] [100964] (2 PDB entries)
  8. 2129103Domain d1jeqb2: 1jeq B:6-241 [90369]
    Other proteins in same PDB: d1jeqa1, d1jeqa3, d1jeqa4, d1jeqb1

Details for d1jeqb2

PDB Entry: 1jeq (more details), 2.7 Å

PDB Description: Crystal Structure of the Ku Heterodimer
PDB Compounds: (B:) Ku80

SCOPe Domain Sequences for d1jeqb2:

Sequence, based on SEQRES records: (download)

>d1jeqb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslgkedgsgdrgdgpfrl
gghgpsfplkgiteqqkegleivkmvmislegedgldeiysfseslrklcvfkkie

Sequence, based on observed residues (ATOM records): (download)

>d1jeqb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslpfrlgghgfplkgite
qqkegleivkmvmislegedgldeiysfseslrklcvfkkie

SCOPe Domain Coordinates for d1jeqb2:

Click to download the PDB-style file with coordinates for d1jeqb2.
(The format of our PDB-style files is described here.)

Timeline for d1jeqb2: