| Class a: All alpha proteins [46456] (151 folds) |
| Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies) |
Superfamily a.140.2: SAP domain [68906] (1 family) ![]() |
| Family a.140.2.1: SAP domain [68907] (2 proteins) |
| Protein DNA binding C-terminal domain of ku70 [68908] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [68909] (2 PDB entries) |
| Domain d1jeqa1: 1jeq A:559-609 [64748] Other proteins in same PDB: d1jeqa2, d1jeqb_ |
PDB Entry: 1jeq (more details), 2.7 Å
SCOP Domain Sequences for d1jeqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens)}
yseeelkthiskgtlgkftvpmlkeacrayglksglkkqellealtkhfqd
Timeline for d1jeqa1: