Lineage for d1jeqb1 (1jeq B:242-542)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077503Fold b.131: SPOC domain-like [100938] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2077504Superfamily b.131.1: SPOC domain-like [100939] (3 families) (S)
  5. 2077510Family b.131.1.2: Ku80 subunit middle domain [100943] (1 protein)
    includes C-terminal alpha-helical arm and DNA encircling insertion
  6. 2077511Protein Ku80 subunit middle domain [100944] (1 species)
  7. 2077512Species Human (Homo sapiens) [TaxId:9606] [100945] (2 PDB entries)
  8. 2077514Domain d1jeqb1: 1jeq B:242-542 [90368]
    Other proteins in same PDB: d1jeqa1, d1jeqa3, d1jeqa4, d1jeqb2

Details for d1jeqb1

PDB Entry: 1jeq (more details), 2.7 Å

PDB Description: Crystal Structure of the Ku Heterodimer
PDB Compounds: (B:) Ku80

SCOPe Domain Sequences for d1jeqb1:

Sequence, based on SEQRES records: (download)

>d1jeqb1 b.131.1.2 (B:242-542) Ku80 subunit middle domain {Human (Homo sapiens) [TaxId: 9606]}
rhsihwpcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclnddd
etevlkediiqgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqv
lkvfaarddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclvy
vqlpfmedlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfpttk
ipnprfqrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfplie
a

Sequence, based on observed residues (ATOM records): (download)

>d1jeqb1 b.131.1.2 (B:242-542) Ku80 subunit middle domain {Human (Homo sapiens) [TaxId: 9606]}
rhsihwpcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclnddd
etevlkediiqgfrygsdivpfdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkv
faarddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclvyvql
pfmedlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfpttkipn
prfqrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfpliea

SCOPe Domain Coordinates for d1jeqb1:

Click to download the PDB-style file with coordinates for d1jeqb1.
(The format of our PDB-style files is described here.)

Timeline for d1jeqb1: