Lineage for d1qhda1 (1qhd A:1-148,A:333-397)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338275Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
    multihelical; three-helical bundle in the core is surrounded by non-conserved helices
  4. 2338276Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) (S)
    this domain is interrupted by a jelly-roll beta-sandwich domain
  5. 2338299Family a.115.1.2: vp6, the major capsid protein of group A rotavirus [63596] (1 protein)
  6. 2338300Protein vp6, the major capsid protein of group A rotavirus [63597] (2 species)
  7. 2338303Species Bovine rotavirus [TaxId:10927] [63598] (1 PDB entry)
  8. 2338304Domain d1qhda1: 1qhd A:1-148,A:333-397 [63324]
    Other proteins in same PDB: d1qhda2
    complexed with ca, cl, zn

Details for d1qhda1

PDB Entry: 1qhd (more details), 1.95 Å

PDB Description: crystal structure of vp6, the major capsid protein of group a rotavirus
PDB Compounds: (A:) viral capsid vp6

SCOPe Domain Sequences for d1qhda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhda1 a.115.1.2 (A:1-148,A:333-397) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus [TaxId: 10927]}
mdvlyslsktlkdardkivegtlysnvsdliqqfnqmiitmngnefqtggignlpirnwn
fdfgllgttllnldanyvetarntidyfvdfvdnvcmdemvresqrngiapqsdslikls
gikfkrinfdnsseyienwnlqnrrqrtXsvladasetmlanvtsvrqeyaipvgpvfpp
gmnwtdlitnyspsrednlqrvftvasirsmlvk

SCOPe Domain Coordinates for d1qhda1:

Click to download the PDB-style file with coordinates for d1qhda1.
(The format of our PDB-style files is described here.)

Timeline for d1qhda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qhda2