SCOPe 2.07: Domain d1qhda2: 1qhd A:149-332

Lineage for d1qhda2 (1qhd A:149-332)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.1: Top domain of virus capsid protein [49819] (3 proteins)
   this domain is inserted into a multihelical domain

6. Protein vp6, the major capsid protein of group A rotavirus [63718] (2 species)

7. Species Bovine rotavirus [TaxId:10927] [63719] (1 PDB entry)

8. Domain d1qhda2: 1qhd A:149-332 [63325]
   Other proteins in same PDB: d1qhda1
   complexed with ca, cl, zn

Details for d1qhda2

PDB Entry: 1qhd, 1.95 Å

PDB Description: crystal structure of vp6, the major capsid protein of group a rotavirus

PDB Compounds: (A:) viral capsid vp6

SCOPe Domain Sequences for d1qhda2:

Sequence; same for both SEQRES and ATOM records:

>d1qhda2 b.19.1.1 (A:149-332) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus [TaxId: 10927]}
gftfhkpnifpysasftlnrsqpahdnlmgtmwlnagseiqvagfdyscainapantqqf
ehivqlrrvlttatitllpdaerfsfprvitsadgattwyfnpvilrpnnveiefllngq
iintyqarfgtiiarnfdtirlsfqlmrppnmtpavaalfpnaqpfehhatvgltlries
avce

Timeline for d1qhda2:

• d1qhda2 first appeared in SCOP 1.57
  
• d1qhda2 appears in SCOPe 2.06
  
• d1qhda2 appears in the current release, SCOPe 2.08