Lineage for d1qhda2 (1qhd A:149-332)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57292Fold b.19: Viral protein domain [49817] (1 superfamily)
  4. 57293Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
  5. 57294Family b.19.1.1: Top domain of virus capsid protein [49819] (2 proteins)
  6. 57320Protein vp6, the major capsid protein of group A rotavirus [63718] (1 species)
  7. 57321Species Bovine rotavirus [TaxId:10927] [63719] (1 PDB entry)
  8. 57322Domain d1qhda2: 1qhd A:149-332 [63325]
    Other proteins in same PDB: d1qhda1

Details for d1qhda2

PDB Entry: 1qhd (more details), 1.95 Å

PDB Description: crystal structure of vp6, the major capsid protein of group a rotavirus

SCOP Domain Sequences for d1qhda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhda2 b.19.1.1 (A:149-332) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus}
gftfhkpnifpysasftlnrsqpahdnlmgtmwlnagseiqvagfdyscainapantqqf
ehivqlrrvlttatitllpdaerfsfprvitsadgattwyfnpvilrpnnveiefllngq
iintyqarfgtiiarnfdtirlsfqlmrppnmtpavaalfpnaqpfehhatvgltlries
avce

SCOP Domain Coordinates for d1qhda2:

Click to download the PDB-style file with coordinates for d1qhda2.
(The format of our PDB-style files is described here.)

Timeline for d1qhda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qhda1