![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) |
![]() | Superfamily b.19.1: Viral protein domain [49818] (3 families) ![]() |
![]() | Family b.19.1.1: Top domain of virus capsid protein [49819] (2 proteins) |
![]() | Protein vp6, the major capsid protein of group A rotavirus [63718] (1 species) |
![]() | Species Bovine rotavirus [TaxId:10927] [63719] (1 PDB entry) |
![]() | Domain d1qhda2: 1qhd A:149-332 [63325] Other proteins in same PDB: d1qhda1 |
PDB Entry: 1qhd (more details), 1.95 Å
SCOP Domain Sequences for d1qhda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhda2 b.19.1.1 (A:149-332) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus} gftfhkpnifpysasftlnrsqpahdnlmgtmwlnagseiqvagfdyscainapantqqf ehivqlrrvlttatitllpdaerfsfprvitsadgattwyfnpvilrpnnveiefllngq iintyqarfgtiiarnfdtirlsfqlmrppnmtpavaalfpnaqpfehhatvgltlries avce
Timeline for d1qhda2: