SCOP 1.57: Domain d1qhda1: 1qhd A:1-148,A:333-397

Lineage for d1qhda1 (1qhd A:1-148,A:333-397)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)

4. Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (2 families)

5. Family a.115.1.2: vp6, the major capsid protein of group A rotavirus [63596] (1 protein)

6. Protein vp6, the major capsid protein of group A rotavirus [63597] (1 species)

7. Species Bovine rotavirus [TaxId:10927] [63598] (1 PDB entry)

8. Domain d1qhda1: 1qhd A:1-148,A:333-397 [63324]
   Other proteins in same PDB: d1qhda2

Details for d1qhda1

PDB Entry: 1qhd, 1.95 Å

PDB Description: crystal structure of vp6, the major capsid protein of group a rotavirus

SCOP Domain Sequences for d1qhda1:

Sequence; same for both SEQRES and ATOM records:

>d1qhda1 a.115.1.2 (A:1-148,A:333-397) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus}
mdvlyslsktlkdardkivegtlysnvsdliqqfnqmiitmngnefqtggignlpirnwn
fdfgllgttllnldanyvetarntidyfvdfvdnvcmdemvresqrngiapqsdslikls
gikfkrinfdnsseyienwnlqnrrqrtXsvladasetmlanvtsvrqeyaipvgpvfpp
gmnwtdlitnyspsrednlqrvftvasirsmlvk

Timeline for d1qhda1:

• d1qhda1 is new in SCOP 1.57
  
• d1qhda1 appears in SCOP 1.59
  
• d1qhda1 appears in the current release, SCOPe 2.08