![]() | Class a: All alpha proteins [46456] (144 folds) |
![]() | Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily) |
![]() | Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (2 families) ![]() |
![]() | Family a.115.1.2: vp6, the major capsid protein of group A rotavirus [63596] (1 protein) |
![]() | Protein vp6, the major capsid protein of group A rotavirus [63597] (1 species) |
![]() | Species Bovine rotavirus [TaxId:10927] [63598] (1 PDB entry) |
![]() | Domain d1qhda1: 1qhd A:1-148,A:333-397 [63324] Other proteins in same PDB: d1qhda2 |
PDB Entry: 1qhd (more details), 1.95 Å
SCOP Domain Sequences for d1qhda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhda1 a.115.1.2 (A:1-148,A:333-397) vp6, the major capsid protein of group A rotavirus {Bovine rotavirus} mdvlyslsktlkdardkivegtlysnvsdliqqfnqmiitmngnefqtggignlpirnwn fdfgllgttllnldanyvetarntidyfvdfvdnvcmdemvresqrngiapqsdslikls gikfkrinfdnsseyienwnlqnrrqrtXsvladasetmlanvtsvrqeyaipvgpvfpp gmnwtdlitnyspsrednlqrvftvasirsmlvk
Timeline for d1qhda1: