Lineage for d1i94c2 (1i94 C:107-207)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79847Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
  4. 79848Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 79849Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 79850Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 79851Species Thermus thermophilus [TaxId:274] [54824] (10 PDB entries)
  8. 79854Domain d1i94c2: 1i94 C:107-207 [61993]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_

Details for d1i94c2

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94c2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1i94c2:

Click to download the PDB-style file with coordinates for d1i94c2.
(The format of our PDB-style files is described here.)

Timeline for d1i94c2: