Lineage for d1i94e1 (1i94 E:74-157)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77712Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 77713Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 77714Family d.14.1.1: Translational machinery components [54212] (3 proteins)
  6. 77722Protein Ribosomal protein S5, C-terminal domain [54215] (2 species)
  7. 77725Species Thermus thermophilus [TaxId:274] [54217] (10 PDB entries)
  8. 77728Domain d1i94e1: 1i94 E:74-157 [61995]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_

Details for d1i94e1

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94e1 d.14.1.1 (E:74-157) Ribosomal protein S5, C-terminal domain {Thermus thermophilus}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkgeah

SCOP Domain Coordinates for d1i94e1:

Click to download the PDB-style file with coordinates for d1i94e1.
(The format of our PDB-style files is described here.)

Timeline for d1i94e1: