Lineage for d1i94m_ (1i94 M:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45908Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 45955Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family) (S)
  5. 45956Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)
  6. 45957Protein Ribosomal protein S13 [46948] (1 species)
  7. 45958Species Thermus thermophilus [TaxId:274] [46949] (10 PDB entries)
  8. 45961Domain d1i94m_: 1i94 M: [62004]
    Other proteins in same PDB: d1i94b_, d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_

Details for d1i94m_

PDB Entry: 1i94 (more details), 3.2 Å

PDB Description: crystal structures of the small ribosomal subunit with tetracycline, edeine and if3

SCOP Domain Sequences for d1i94m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i94m_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrr

SCOP Domain Coordinates for d1i94m_:

Click to download the PDB-style file with coordinates for d1i94m_.
(The format of our PDB-style files is described here.)

Timeline for d1i94m_: