![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (17 superfamilies) |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52316] (10 PDB entries) |
![]() | Domain d1i94b_: 1i94 B: [61991] Other proteins in same PDB: d1i94c1, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_ |
PDB Entry: 1i94 (more details), 3.2 Å
SCOP Domain Sequences for d1i94b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i94b_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus} pveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedl amrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleeleal faspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklf ipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqe aeatetpeg
Timeline for d1i94b_: