| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies) |
Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family) ![]() |
| Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins) |
| Protein Ribosomal protein S3 N-terminal domain [54816] (1 species) |
| Species Thermus thermophilus [TaxId:274] [54817] (10 PDB entries) |
| Domain d1i94c1: 1i94 C:2-106 [61992] Other proteins in same PDB: d1i94b_, d1i94c2, d1i94d_, d1i94e1, d1i94e2, d1i94f_, d1i94g_, d1i94h_, d1i94i_, d1i94j_, d1i94k_, d1i94l_, d1i94m_, d1i94n_, d1i94o_, d1i94p_, d1i94q_, d1i94r_, d1i94s_, d1i94t_, d1i94u_ |
PDB Entry: 1i94 (more details), 3.2 Å
SCOP Domain Sequences for d1i94c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i94c1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqev
Timeline for d1i94c1: