Lineage for d1i8ff1 (1i8f F:5-80)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2786773Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2786869Species Pyrobaculum aerophilum [TaxId:13773] [63760] (2 PDB entries)
    smap1
  8. 2786875Domain d1i8ff1: 1i8f F:5-80 [61964]
    Other proteins in same PDB: d1i8fc2, d1i8fd2, d1i8ff2
    complexed with gol

Details for d1i8ff1

PDB Entry: 1i8f (more details), 1.75 Å

PDB Description: the crystal structure of a heptameric archaeal sm protein: implications for the eukaryotic snrnp core
PDB Compounds: (F:) putative snrnp sm-like protein

SCOPe Domain Sequences for d1i8ff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8ff1 b.38.1.1 (F:5-80) Archaeal homoheptameric Sm protein {Pyrobaculum aerophilum [TaxId: 13773]}
iskcfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrg
tmvvrgenvlfispvp

SCOPe Domain Coordinates for d1i8ff1:

Click to download the PDB-style file with coordinates for d1i8ff1.
(The format of our PDB-style files is described here.)

Timeline for d1i8ff1: