SCOP 1.57: Domain d1i8ff_: 1i8f F:

Lineage for d1i8ff_ (1i8f F:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)

4. Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)

6. Protein Archaeal homoheptameric Sm protein [63758] (3 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [63760] (1 PDB entry)

8. Domain d1i8ff_: 1i8f F: [61964]

Details for d1i8ff_

PDB Entry: 1i8f, 1.75 Å

PDB Description: the crystal structure of a heptameric archaeal sm protein: implications for the eukaryotic snrnp core

SCOP Domain Sequences for d1i8ff_:

Sequence; same for both SEQRES and ATOM records:

>d1i8ff_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum}
iskcfatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrg
tmvvrgenvlfispvpg

Timeline for d1i8ff_:

• d1i8ff_ is new in SCOP 1.57
  
• d1i8ff_ appears in SCOP 1.59
  
• d1i8ff_ appears in the current release, SCOPe 2.08, called d1i8ff1