Lineage for d1hsjb1 (1hsj B:373-487)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693777Protein Staphylococcal accessory regulator A homolog, SarR [63472] (1 species)
  7. 2693778Species Staphylococcus aureus [TaxId:1280] [63473] (1 PDB entry)
  8. 2693780Domain d1hsjb1: 1hsj B:373-487 [61239]
    Other proteins in same PDB: d1hsja2, d1hsjb2
    Fusion protein with E. coli MBP
    protein/DNA complex; complexed with glc

    missing some secondary structures that made up less than one-third of the common domain

Details for d1hsjb1

PDB Entry: 1hsj (more details), 2.3 Å

PDB Description: sarr mbp fusion structure
PDB Compounds: (B:) fusion protein consisting of staphylococcus accessory regulator protein r and maltose binding protein

SCOPe Domain Sequences for d1hsjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsjb1 a.4.5.28 (B:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]}
mskindindlvnatfqvkkffrdtkkkfnlnyeeiyilnhilrsesneisskeiakcsef
kpyyltkalqklkdlkllskkrslqdertvivyvtdtqkaniqkliseleeyikn

SCOPe Domain Coordinates for d1hsjb1:

Click to download the PDB-style file with coordinates for d1hsjb1.
(The format of our PDB-style files is described here.)

Timeline for d1hsjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hsjb2