PDB entry 1hsj

View 1hsj on RCSB PDB site
Description: sarr mbp fusion structure
Class: Transcription/Sugar Binding Protein
Keywords: Novel fold for DNA binding, Transcription-Sugar Binding Protein COMPLEX
Deposited on 2000-12-26, released 2001-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fusion protein consisting of staphylococcus accessory regulator protein r and maltose binding protein
    Species: , [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEY0 (0-360)
      • linker (361-371)
    • Uniprot Q2YYV0 (372-486)
    Domains in SCOPe 2.07: d1hsja1, d1hsja2
  • Chain 'B':
    Compound: fusion protein consisting of staphylococcus accessory regulator protein r and maltose binding protein
    Species: , [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEY0 (0-360)
      • linker (361-371)
    • Uniprot Q2YYV0 (372-486)
    Domains in SCOPe 2.07: d1hsjb1, d1hsjb2
  • Heterogens: GLC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hsjA (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    laaaqtnaaaefmskindindlvnatfqvkkffrdtkkkfnlnyeeiyilnhilrsesne
    isskeiakcsefkpyyltkalqklkdlkllskkrslqdertvivyvtdtqkaniqklise
    leeyikn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hsjB (B:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    laaaqtnaaaefmskindindlvnatfqvkkffrdtkkkfnlnyeeiyilnhilrsesne
    isskeiakcsefkpyyltkalqklkdlkllskkrslqdertvivyvtdtqkaniqklise
    leeyikn