PDB entry 1hsj

View 1hsj on RCSB PDB site
Description: sarr mbp fusion structure
Class: Transcription/Sugar Binding Protein
Keywords: Novel fold for DNA binding, Transcription/Sugar Binding Protein COMPLEX
Deposited on 2000-12-26, released 2001-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.263
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fusion protein consisting of staphylococcus accessary regulator protein r and maltose binding protein
    Species: Escherichia coli, Staphylococcus aureus [TaxId:562,1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02928 (0-369)
      • engineered (361-362)
      • engineered (367-369)
      • cloning artifact (370-371)
    • GB AAG35715 (372-486)
    Domains in SCOPe 2.06: d1hsja1, d1hsja2
  • Chain 'B':
    Compound: fusion protein consisting of staphylococcus accessary regulator protein r and maltose binding protein
    Species: Escherichia coli, Staphylococcus aureus [TaxId:562,1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02928 (0-369)
      • engineered (361-362)
      • engineered (367-369)
      • cloning artifact (370-371)
    • GB AAG35715 (372-486)
    Domains in SCOPe 2.06: d1hsjb1, d1hsjb2
  • Heterogens: GLC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hsjA (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    laaaqtnaaaefmskindindlvnatfqvkkffrdtkkkfnlnyeeiyilnhilrsesne
    isskeiakcsefkpyyltkalqklkdlkllskkrslqdertvivyvtdtqkaniqklise
    leeyikn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hsjB (B:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    laaaqtnaaaefmskindindlvnatfqvkkffrdtkkkfnlnyeeiyilnhilrsesne
    isskeiakcsefkpyyltkalqklkdlkllskkrslqdertvivyvtdtqkaniqklise
    leeyikn