Lineage for d1hjbe_ (1hjb E:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039471Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 3039472Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 3039503Protein C/ebp beta [57985] (2 species)
  7. 3039504Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)
  8. 3039524Domain d1hjbe_: 1hjb E: [61077]
    Other proteins in same PDB: d1hjbc_, d1hjbf_
    homodimer
    protein/DNA complex

Details for d1hjbe_

PDB Entry: 1hjb (more details), 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter
PDB Compounds: (E:) ccaat/enhancer binding protein beta

SCOPe Domain Sequences for d1hjbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjbe_ h.1.3.1 (E:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
dkhsdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstl
rnlfkqlp

SCOPe Domain Coordinates for d1hjbe_:

Click to download the PDB-style file with coordinates for d1hjbe_.
(The format of our PDB-style files is described here.)

Timeline for d1hjbe_: